Skip to Content

Anti-RCC1L antibody produced in rabbit (100 μL)

Marca: Sigma-Aldrich Número de catálogo: HPA060643 Presentación: 100 μL Prestige Antibodies ® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution Especificaciones: - Biological source: rabbit - Quality level: 100 - Conjugate: unconjugated - Antibody form: affinity isolated antibody - Antibody product type: primary antibodies - Clone: polyclonal - Product line: Prestige Antibodies ® Powered by Atlas Antibodies - Form: buffered aqueous glycerol solution - Species reactivity: human - Techniques: immunohistochemistry: 1:20- 1:50 - Immunogen sequence: TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN - Shipped in: wet ice - Storage temperature: −20°C - Target post-translational modification: unmodified - Gene information: human ... WBSCR16(81554)
620.40 620.40

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days