Skip to Content

Anti-CNP antibody produced in rabbit (100 μL)

Marca: Sigma-Aldrich Número de catálogo: HPA023278 Presentación: 100 μL Prestige Antibodies ® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2 Especificaciones: - Biological source: rabbit - Quality level: 100 - Conjugate: unconjugated - Antibody form: affinity isolated antibody - Antibody product type: primary antibodies - Clone: polyclonal - Product line: Prestige Antibodies ® Powered by Atlas Antibodies - Form: buffered aqueous glycerol solution - Species reactivity: human - Enhanced validation: orthogonal RNAseq independent Learn more about Antibody Enhanced Validation - Techniques: immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:1000-1:2500 - Immunogen sequence: GCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII - UniProt accession no.: P09543 - Shipped in: wet ice - Storage temperature: −20°C - Target post-translational modification: unmodified - Gene information: human ... CNP(1267)
565.40 565.40

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days