Skip to Content

Anti-NELL1 antibody produced in rabbit (100 μL)

Marca: Sigma-Aldrich Número de catálogo: HPA051535 Presentación: 100 μL Prestige Antibodies ® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution Especificaciones: - Biological source: rabbit - Quality level: 100 - Conjugate: unconjugated - Antibody form: affinity isolated antibody - Antibody product type: primary antibodies - Clone: polyclonal - Product line: Prestige Antibodies ® Powered by Atlas Antibodies - Form: buffered aqueous glycerol solution - Species reactivity: human - Techniques: immunohistochemistry: 1:50-1:200 - Immunogen sequence: CHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECK - UniProt accession no.: Q92832 - Shipped in: wet ice - Storage temperature: −20°C - Target post-translational modification: unmodified - Gene information: human ... NELL1(4745)
565.40 565.40

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days